PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01010221001
Common NameVIT_01s0010g01530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 195aa    MW: 21765.2 Da    PI: 9.7388
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01010221001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.51.7e-231764249
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       +i+n+sn qvtfskRr+g++KKA+EL++LC+ae a+iifs+  k+y +
  GSVIVT01010221001 17 KIKNESNLQVTFSKRRAGLFKKASELCTLCGAETAIIIFSPGKKIYSF 64
                       79*******************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-30867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.235868IPR002100Transcription factor, MADS-box
CDDcd002659.12E-35977No hitNo description
SuperFamilySSF554551.83E-26980IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-191030IPR002100Transcription factor, MADS-box
PfamPF003198.5E-251764IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-193045IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-194566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MATVRKSKGR QRIEIAKIKN ESNLQVTFSK RRAGLFKKAS ELCTLCGAET AIIIFSPGKK  60
IYSFGHPCIE SIIDRFLARN PFLNAGALQL FQAHLEAEKK RGEALDKTTK AFQRQCWWAA  120
PVEELNLEQL QMLKVSLEML RKKVERQADK LIIEASEPPA FSAPYSVGAI PPYEPQTAGF  180
DPQGSTFGFD GHFF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4286261e-168AM428626.2 Vitis vinifera contig VV78X181169.22, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002272514.11e-138PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK29e-51AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7TAE61e-142D7TAE6_VITVI; Putative uncharacterized protein
STRINGVIT_01s0010g01530.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-52AGAMOUS-like 62